PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G021300.2
Common NameB456_003G021300, LOC105787594
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 276aa    MW: 30729 Da    PI: 6.3774
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G021300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.9e-33150205156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFvea+++LGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Gorai.003G021300.2 150 KQRRCWSPELHKRFVEALQKLGGSKVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 205
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.212147207IPR017930Myb domain
SuperFamilySSF466896.46E-19148208IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-29149208IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-27150205IPR006447Myb domain, plants
PfamPF002493.6E-9152203IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MMCKELGDGS VTIDEGNGKV NKENDGGAGN KRNWLSTVQL WNSDSEKVDQ NKKPNKVPGL  60
KLGSEEEEEE EQDMFEDPIE FFNNRRFKGQ MDKENLELSL MTPSFDLGSS SPSHNPILKI  120
NDNCKTGFGS DQNQTKFQTK HQQDMQNCKK QRRCWSPELH KRFVEALQKL GGSKVATPKQ  180
IRELMQVDGL TNDEVKSHLQ KYRLHFRKVA SDSSAQNQCN EKMKANISES DSPQGPLRAG  240
GWAKGLSSGG SVVEGEDDEK SDGRSWRSGG TKTGD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8377000.0JQ837700.1 Gossypium hirsutum cultivar ZM3 MYB mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469518.10.0PREDICTED: probable transcription factor KAN3
TrEMBLA0A0D2MI740.0A0A0D2MI74_G
TrEMBLA0A0D2RFB90.0A0A0D2RFB9_G
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.12e-33G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]